Glow Blend (GHK-Cu/BPC-157/TB-500) is a synthetic peptide blend meticulously prepared for scientific inquiry. This product, combining GHK-Cu, BPC-157, and TB-500, is synthesized with high purity for laboratory investigations. It is developed for use in various research applications. Glow Blend is designated solely for research and development purposes.
GHK-Cu is a tripeptide with the sequence Gly-His-Lys complexed with copper(II), having a molecular weight of about 403 Da and a square-planar coordination that enhances stability. BPC-157 features a 15-amino-acid sequence (GEPPPGKPADDAGLV) with a molecular weight around 1,419 Da, noted for its high stability in gastric environments. TB-500 is a 43-amino-acid peptide (SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES) weighing approximately 4,963 Da, with a central actin-binding domain. In combination, their structures support mutual compatibility, with GHK-Cu's copper binding potentially aiding BPC-157's and TB-500's cellular interactions without aggregation.
Supplied as a lyophilized powder blend, our product ensures purity over 98% for each component via HPLC and mass spectrometry. The mixture dissolves well in neutral buffers, and our transparent testing confirms batch-to-batch reliability for your assays.
The GHK-Cu/BPC-157/TB-500 combination integrates three distinct peptides—GHK-Cu, a tripeptide-copper complex; BPC-157, a pentadecapeptide derived from gastric proteins; and TB-500, the synthetic form of thymosin beta-4—to investigate synergistic effects on tissue repair, inflammation reduction, and cellular regeneration in experimental models. This blend harnesses GHK-Cu's antioxidant and wound-healing properties, BPC-157's cytoprotective actions, and TB-500's actin-modulating capabilities, potentially amplifying outcomes in studies of musculoskeletal healing and metabolic stress. As with all our peptides, the GHK-Cu/BPC-157/TB-500 combination is supplied strictly for research purposes and in-vitro use only—not for human consumption or any therapeutic applications.
GHK-Cu functions by modulating gene expression for collagen and elastin while exhibiting antioxidant effects through copper-mediated ROS quenching and NF-κB inhibition. BPC-157 promotes cytoprotection by upregulating growth hormone receptors, modulating NO systems, and inhibiting TGF-β to reduce fibrosis. TB-500 sequesters G-actin to facilitate cell migration and angiogenesis via VEGF upregulation, also suppressing inflammation. Together, they may synergize in repair pathways, with GHK-Cu's anti-inflammatory role complementing BPC-157's vascular support and TB-500's cytoskeletal remodeling for enhanced tissue resilience.
This integrated action offers a multifaceted approach to studying healing, and we're here to help rationalize how it fits your models.
In summary, the GHK-Cu/BPC-157/TB-500 combination offers a robust platform for probing regenerative synergies, blending antioxidant, cytoprotective, and cytoskeletal mechanisms in controlled settings. Its potential inspires our commitment to quality peptides that advance science with integrity. Strictly for in-vitro research, this blend embodies our approachable expertise. Let's collaborate on your next breakthrough, one experiment at a time.
The GHK-Cu/BPC-157/TB-500 blend is versatile for in-vitro research in wound healing and neurodegeneration. GHK-Cu has been studied in skin models for promoting angiogenesis and reducing oxidative stress. BPC-157 aids tendon fibroblast assays by enhancing collagen organization and nerve growth factor expression. TB-500 supports myocardial cultures by boosting progenitor cell recruitment and remyelination. Combined, they may accelerate recovery in injury simulations, as explored in soft tissue regeneration studies.
We recommend it for co-culture experiments, with our guidance to optimize for clear results.
Store the lyophilized blend at -20°C in a dry, dark container. Reconstitute with sterile water to 1-2 mg/mL per peptide, gently mixing. Aliquot and freeze, avoiding thaw cycles.
Our tests ensure stability, but verify pH before use. Contact us for tips.
The GHK-Cu/BPC-157/TB-500 combination integrates three distinct peptides—GHK-Cu, a tripeptide-copper complex; BPC-157, a pentadecapeptide derived from gastric proteins; and TB-500, the synthetic form of thymosin beta-4—to investigate synergistic effects on tissue repair, inflammation reduction, and cellular regeneration in experimental models. This blend harnesses GHK-Cu's antioxidant and wound-healing properties, BPC-157's cytoprotective actions, and TB-500's actin-modulating capabilities, potentially amplifying outcomes in studies of musculoskeletal healing and metabolic stress. As with all our peptides, the GHK-Cu/BPC-157/TB-500 combination is supplied strictly for research purposes and in-vitro use only—not for human consumption or any therapeutic applications.
GHK-Cu functions by modulating gene expression for collagen and elastin while exhibiting antioxidant effects through copper-mediated ROS quenching and NF-κB inhibition. BPC-157 promotes cytoprotection by upregulating growth hormone receptors, modulating NO systems, and inhibiting TGF-β to reduce fibrosis. TB-500 sequesters G-actin to facilitate cell migration and angiogenesis via VEGF upregulation, also suppressing inflammation. Together, they may synergize in repair pathways, with GHK-Cu's anti-inflammatory role complementing BPC-157's vascular support and TB-500's cytoskeletal remodeling for enhanced tissue resilience.
This integrated action offers a multifaceted approach to studying healing, and we're here to help rationalize how it fits your models.
In summary, the GHK-Cu/BPC-157/TB-500 combination offers a robust platform for probing regenerative synergies, blending antioxidant, cytoprotective, and cytoskeletal mechanisms in controlled settings. Its potential inspires our commitment to quality peptides that advance science with integrity. Strictly for in-vitro research, this blend embodies our approachable expertise. Let's collaborate on your next breakthrough, one experiment at a time.
GHK-Cu is a tripeptide with the sequence Gly-His-Lys complexed with copper(II), having a molecular weight of about 403 Da and a square-planar coordination that enhances stability. BPC-157 features a 15-amino-acid sequence (GEPPPGKPADDAGLV) with a molecular weight around 1,419 Da, noted for its high stability in gastric environments. TB-500 is a 43-amino-acid peptide (SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES) weighing approximately 4,963 Da, with a central actin-binding domain. In combination, their structures support mutual compatibility, with GHK-Cu's copper binding potentially aiding BPC-157's and TB-500's cellular interactions without aggregation.
Supplied as a lyophilized powder blend, our product ensures purity over 98% for each component via HPLC and mass spectrometry. The mixture dissolves well in neutral buffers, and our transparent testing confirms batch-to-batch reliability for your assays.
The GHK-Cu/BPC-157/TB-500 blend is versatile for in-vitro research in wound healing and neurodegeneration. GHK-Cu has been studied in skin models for promoting angiogenesis and reducing oxidative stress. BPC-157 aids tendon fibroblast assays by enhancing collagen organization and nerve growth factor expression. TB-500 supports myocardial cultures by boosting progenitor cell recruitment and remyelination. Combined, they may accelerate recovery in injury simulations, as explored in soft tissue regeneration studies.
We recommend it for co-culture experiments, with our guidance to optimize for clear results.
Store the lyophilized blend at -20°C in a dry, dark container. Reconstitute with sterile water to 1-2 mg/mL per peptide, gently mixing. Aliquot and freeze, avoiding thaw cycles.
Our tests ensure stability, but verify pH before use. Contact us for tips.
